Operations — SEDA 0.5 documentation
Filtering by sequence length (for FASTQ/FASTA) · Issue #9 · shenwei356/seqkit · GitHub
PDF) FilterByLength : Filter fasta sequences by length and count the sequences in a multifasta file
Extract FASTA sequences based on sequence length using Perl — Bioinformatics Review
Fasta - angsd
Querying data — BIGSdb 1.14.0 documentation
All samples dropped during augur filter - Nextstrain Discussion
Biopython Tutorial and Cookbook
FASTA file of fixed length
Annotation for de novo Assembled Seq. Contents 1 FASTA File Length Filter 2 Gene Prediction Choose GENSCAN or GeneMark.hmm 3 Gene Prediction to FASTA Converts GENSCAN or GeneMark.hmm output file to FASTA format 4 transcriptsToOrfs Trinity ...
Operations — SEDA 0.3 documentation
How to
Extract FASTA sequences based on sequence length using Perl — Bioinformatics Review
JCAST: Sample-specific protein isoform databases for mass spectrometry-based proteomics experiments - ScienceDirect
PRINSEQ @ SourceForge.net
1 Sequence formats >FOSB_MOUSE Protein fosB. 338 bp MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTA ITTSQDLQWLVQPTLISSMAQSQGQPLASQPPAVDPYDMPGTSYSTPGLSAYSTGGASGS. - ppt download
SeqKit: a cross-platform and ultrafast toolkit for FASTA/Q file manipulation in Golang
GuideFinder workflow. Users set parameters and input FASTA files.... | Download Scientific Diagram
Fasta filer by length fails when max_length !=0 · Issue #536 · galaxyproject/tools-devteam · GitHub
Wymore - Resources
Length Filter a Fasta – Subterranaut
Filter out Short Sequences - Unipro UGENE User Manual v. 34 - WIKI
Biotechvana
INPUT DATA In this section, the user must define the input for the prediction server following these steps: 1) Specify the desired type of input data (FASTA or PEPTIDE) using the drop down menu. 2) Provide the input data by means of pasting the data into the ...
Help pages for anvi'o programs and artifacts
